Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM
Anwendungsbeschreibung:
Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS2 Rabbit Polyclonal Antibody (orb325283). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten