TMPRSS2 Peptide - C-terminal region

Artikelnummer: BYT-ORB2002539
Artikelname: TMPRSS2 Peptide - C-terminal region
Artikelnummer: BYT-ORB2002539
Hersteller Artikelnummer: orb2002539
Alternativnummer: BYT-ORB2002539-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: PP9284, PRSS10
TMPRSS2 Peptide - C-terminal region
NCBI: 005647
UniProt: O15393
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS2 Rabbit Polyclonal Antibody (orb325283). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings