TMPRSS2 Peptide - C-terminal region

Catalog Number: BYT-ORB2002539
Article Name: TMPRSS2 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2002539
Supplier Catalog Number: orb2002539
Alternative Catalog Number: BYT-ORB2002539-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: PP9284, PRSS10
TMPRSS2 Peptide - C-terminal region
Molecular Weight: 54kDa
NCBI: 005647
UniProt: O15393
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS2 Rabbit Polyclonal Antibody (orb325283). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings