POMP Peptide - C-terminal region

Produktübersicht

• Artikelname: POMP Peptide - C-terminal region
• Artikelnummer: BYT-ORB2002650
• Hersteller Artikelnummer: orb2002650
• Alternativnummer: BYT-ORB2002650-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: POMP,C13orf12, UMP1,

Produktbeschreibung

POMP Peptide - C-terminal region

Produkteigenschaften

• Molekulargewicht: 15kDa
• NCBI: 057016
• UniProt: Q9Y244
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: EFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with POMP Rabbit Polyclonal Antibody (orb583309). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings