POMP Peptide - C-terminal region

Product Overview

• Article Name: POMP Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2002650
• Supplier Catalog Number: orb2002650
• Alternative Catalog Number: BYT-ORB2002650-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: POMP,C13orf12, UMP1,

Product Description

POMP Peptide - C-terminal region

Product Properties

• Molecular Weight: 15kDa
• NCBI: 057016
• UniProt: Q9Y244
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with POMP Rabbit Polyclonal Antibody (orb583309). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings