S100A6 Peptide - middle region

Produktübersicht

• Artikelname: S100A6 Peptide - middle region
• Artikelnummer: BYT-ORB2002652
• Hersteller Artikelnummer: orb2002652
• Alternativnummer: BYT-ORB2002652-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: 2A9, PRA, 5B10, CABP, CACY, S10A6

Produktbeschreibung

S100A6 Peptide - middle region

Produkteigenschaften

• Molekulargewicht: 9kDa
• NCBI: 055439
• UniProt: P06703
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with S100A6 Rabbit Polyclonal Antibody (orb326119). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings