S100A6 Peptide - middle region

Product Overview

• Article Name: S100A6 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2002652
• Supplier Catalog Number: orb2002652
• Alternative Catalog Number: BYT-ORB2002652-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 2A9, PRA, 5B10, CABP, CACY, S10A6

Product Description

S100A6 Peptide - middle region

Product Properties

• Molecular Weight: 9kDa
• NCBI: 055439
• UniProt: P06703
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with S100A6 Rabbit Polyclonal Antibody (orb326119). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings