PFDN2 Peptide - C-terminal region

Artikelnummer: BYT-ORB2002653
Artikelname: PFDN2 Peptide - C-terminal region
Artikelnummer: BYT-ORB2002653
Hersteller Artikelnummer: orb2002653
Alternativnummer: BYT-ORB2002653-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: PFD2
PFDN2 Peptide - C-terminal region
Molekulargewicht: 16kDa
NCBI: 036526
UniProt: Q9UHV9
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: ETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGV
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PFDN2 Rabbit Polyclonal Antibody (orb583288). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings