PFDN2 Peptide - C-terminal region

Product Overview

• Article Name: PFDN2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2002653
• Supplier Catalog Number: orb2002653
• Alternative Catalog Number: BYT-ORB2002653-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: PFD2

Product Description

PFDN2 Peptide - C-terminal region

Product Properties

• Molecular Weight: 16kDa
• NCBI: 036526
• UniProt: Q9UHV9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PFDN2 Rabbit Polyclonal Antibody (orb583288). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings