SCO1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2002654
Artikelname: SCO1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2002654
Hersteller Artikelnummer: orb2002654
Alternativnummer: BYT-ORB2002654-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: SCO1,SCOD1,
SCO1 Peptide - C-terminal region
Molekulargewicht: 33kDa
UniProt: O75880
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: PGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRP
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SCO1 Rabbit Polyclonal Antibody (orb583227). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings