SCO1 Peptide - C-terminal region

Product Overview

• Article Name: SCO1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2002654
• Supplier Catalog Number: orb2002654
• Alternative Catalog Number: BYT-ORB2002654-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: SCO1,SCOD1,

Product Description

SCO1 Peptide - C-terminal region

Product Properties

• Molecular Weight: 33kDa
• UniProt: O75880
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SCO1 Rabbit Polyclonal Antibody (orb583227). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings