PFKFB3 Peptide - C-terminal region

Produktübersicht

• Artikelname: PFKFB3 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2002655
• Hersteller Artikelnummer: orb2002655
• Alternativnummer: BYT-ORB2002655-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: PFK2, IPFK2, iPFK-2

Produktbeschreibung

PFKFB3 Peptide - C-terminal region

Produkteigenschaften

• Molekulargewicht: 57kDa
• UniProt: Q16875
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: VESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVAS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PFKFB3 Rabbit Polyclonal Antibody (orb326110). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings