PFKFB3 Peptide - C-terminal region

Product Overview

• Article Name: PFKFB3 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2002655
• Supplier Catalog Number: orb2002655
• Alternative Catalog Number: BYT-ORB2002655-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: PFK2, IPFK2, iPFK-2

Product Description

PFKFB3 Peptide - C-terminal region

Product Properties

• Molecular Weight: 57kDa
• UniProt: Q16875
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: VESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVAS

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PFKFB3 Rabbit Polyclonal Antibody (orb326110). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings