PTPN11 Peptide - N-terminal region

Produktübersicht

• Artikelname: PTPN11 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2002657
• Hersteller Artikelnummer: orb2002657
• Alternativnummer: BYT-ORB2002657-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: CFC, NS1, JMML, SHP2, BPTP3, PTP2C, METCDS, PTP-1D, SH-PTP2, SH-PTP3

Produktbeschreibung

PTPN11 Peptide - N-terminal region

Produkteigenschaften

• Molekulargewicht: 65kDa
• NCBI: 006719589
• UniProt: Q06124
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: KSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PTPN11 Rabbit Polyclonal Antibody (orb326107). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings