PTPN11 Peptide - N-terminal region

Product Overview

• Article Name: PTPN11 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2002657
• Supplier Catalog Number: orb2002657
• Alternative Catalog Number: BYT-ORB2002657-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CFC, NS1, JMML, SHP2, BPTP3, PTP2C, METCDS, PTP-1D, SH-PTP2, SH-PTP3

Product Description

PTPN11 Peptide - N-terminal region

Product Properties

• Molecular Weight: 65kDa
• NCBI: 006719589
• UniProt: Q06124
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PTPN11 Rabbit Polyclonal Antibody (orb326107). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings