MAPK11 Peptide - N-terminal region

Produktübersicht

• Artikelname: MAPK11 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2002658
• Hersteller Artikelnummer: orb2002658
• Alternativnummer: BYT-ORB2002658-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2

Produktbeschreibung

MAPK11 Peptide - N-terminal region

Produkteigenschaften

• Molekulargewicht: 40kDa
• NCBI: 002742
• UniProt: Q15759
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MAPK11 Rabbit Polyclonal Antibody (orb326105). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings