MAPK11 Peptide - N-terminal region

Product Overview

• Article Name: MAPK11 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2002658
• Supplier Catalog Number: orb2002658
• Alternative Catalog Number: BYT-ORB2002658-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2

Product Description

MAPK11 Peptide - N-terminal region

Product Properties

• Molecular Weight: 40kDa
• NCBI: 002742
• UniProt: Q15759
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MAPK11 Rabbit Polyclonal Antibody (orb326105). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings