MAPK6 Peptide - N-terminal region

Produktübersicht

• Artikelname: MAPK6 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2002659
• Hersteller Artikelnummer: orb2002659
• Alternativnummer: BYT-ORB2002659-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: ERK3, PRKM6, p97MAPK, HsT17250

Produktbeschreibung

MAPK6 Peptide - N-terminal region

Produkteigenschaften

• Molekulargewicht: 79kDa
• NCBI: 005254596
• UniProt: Q16659
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MAPK6 Rabbit Polyclonal Antibody (orb326104). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings