MAPK6 Peptide - N-terminal region

Product Overview

• Article Name: MAPK6 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2002659
• Supplier Catalog Number: orb2002659
• Alternative Catalog Number: BYT-ORB2002659-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ERK3, PRKM6, p97MAPK, HsT17250

Product Description

MAPK6 Peptide - N-terminal region

Product Properties

• Molecular Weight: 79kDa
• NCBI: 005254596
• UniProt: Q16659
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQ

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MAPK6 Rabbit Polyclonal Antibody (orb326104). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings