RSPH10B Peptide - N-terminal region

Artikelnummer: BYT-ORB2002660
Artikelname: RSPH10B Peptide - N-terminal region
Artikelnummer: BYT-ORB2002660
Hersteller Artikelnummer: orb2002660
Alternativnummer: BYT-ORB2002660-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
RSPH10B Peptide - N-terminal region
Molekulargewicht: 30kDa
UniProt: B2RC85
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: THTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSN
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with RSPH10B Rabbit Polyclonal Antibody (orb326068). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings