RSPH10B Peptide - N-terminal region

Product Overview

• Article Name: RSPH10B Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2002660
• Supplier Catalog Number: orb2002660
• Alternative Catalog Number: BYT-ORB2002660-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

RSPH10B Peptide - N-terminal region

Product Properties

• Molecular Weight: 30kDa
• UniProt: B2RC85
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: THTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSN

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with RSPH10B Rabbit Polyclonal Antibody (orb326068). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings