DNAJA4 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004105
Artikelname: DNAJA4 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004105
Hersteller Artikelnummer: orb2004105
Alternativnummer: BYT-ORB2004105-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: MST104, MSTP104, PRO1472
DNAJA4 Peptide - C-terminal region
NCBI: 001123654
UniProt: Q8WW22
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with DNAJA4 Rabbit Polyclonal Antibody (orb326178). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings