DNAJA4 Peptide - C-terminal region

Product Overview

• Article Name: DNAJA4 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004105
• Supplier Catalog Number: orb2004105
• Alternative Catalog Number: BYT-ORB2004105-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MST104, MSTP104, PRO1472

Product Description

DNAJA4 Peptide - C-terminal region

Product Properties

• NCBI: 001123654
• UniProt: Q8WW22
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DNAJA4 Rabbit Polyclonal Antibody (orb326178). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings