ACTL6B Peptide - middle region

Produktübersicht

• Artikelname: ACTL6B Peptide - middle region
• Artikelnummer: BYT-ORB2004107
• Hersteller Artikelnummer: orb2004107
• Alternativnummer: BYT-ORB2004107-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: ACTL6, BAF53B, arpNalpha

Produktbeschreibung

ACTL6B Peptide - middle region

Produkteigenschaften

• NCBI: 057272
• UniProt: O94805
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ACTL6B Rabbit Polyclonal Antibody (orb583344). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings