ACTL6B Peptide - middle region

Product Overview

• Article Name: ACTL6B Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004107
• Supplier Catalog Number: orb2004107
• Alternative Catalog Number: BYT-ORB2004107-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ACTL6, BAF53B, arpNalpha

Product Description

ACTL6B Peptide - middle region

Product Properties

• NCBI: 057272
• UniProt: O94805
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ACTL6B Rabbit Polyclonal Antibody (orb583344). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings