PROSER2 Peptide - C-terminal region

Produktübersicht

• Artikelname: PROSER2 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004109
• Hersteller Artikelnummer: orb2004109
• Alternativnummer: BYT-ORB2004109-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: C10orf47,

Produktbeschreibung

PROSER2 Peptide - C-terminal region

Produkteigenschaften

• UniProt: D3DRR9
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PROSER2 Rabbit Polyclonal Antibody (orb55698). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings