PROSER2 Peptide - C-terminal region

Product Overview

• Article Name: PROSER2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004109
• Supplier Catalog Number: orb2004109
• Alternative Catalog Number: BYT-ORB2004109-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: C10orf47,

Product Description

PROSER2 Peptide - C-terminal region

Product Properties

• UniProt: D3DRR9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PROSER2 Rabbit Polyclonal Antibody (orb55698). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings