FAM227B Peptide - N-terminal region

Produktübersicht

• Artikelname: FAM227B Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004113
• Hersteller Artikelnummer: orb2004113
• Alternativnummer: BYT-ORB2004113-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: C15orf33

Produktbeschreibung

FAM227B Peptide - N-terminal region

Produkteigenschaften

• NCBI: 689860
• UniProt: Q96M60
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: EYSLILQNHTSEIFKWKSMISETSSYRKLERYGEFLKKYHKKKKIMLSDE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with FAM227B Rabbit Polyclonal Antibody (orb325818). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings