FAM227B Peptide - N-terminal region

Catalog Number: BYT-ORB2004113
Article Name: FAM227B Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004113
Supplier Catalog Number: orb2004113
Alternative Catalog Number: BYT-ORB2004113-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: C15orf33
FAM227B Peptide - N-terminal region
NCBI: 689860
UniProt: Q96M60
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: EYSLILQNHTSEIFKWKSMISETSSYRKLERYGEFLKKYHKKKKIMLSDE
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with FAM227B Rabbit Polyclonal Antibody (orb325818). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings