C11orf65 Peptide - N-terminal region

Produktübersicht

• Artikelname: C11orf65 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004114
• Hersteller Artikelnummer: orb2004114
• Alternativnummer: BYT-ORB2004114-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

C11orf65 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 689800
• UniProt: Q8NCR3
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: YAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with C11orf65 Rabbit Polyclonal Antibody (orb581924). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings