C11orf65 Peptide - N-terminal region

Product Overview

• Article Name: C11orf65 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004114
• Supplier Catalog Number: orb2004114
• Alternative Catalog Number: BYT-ORB2004114-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

C11orf65 Peptide - N-terminal region

Product Properties

• NCBI: 689800
• UniProt: Q8NCR3
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: YAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with C11orf65 Rabbit Polyclonal Antibody (orb581924). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings