AK8 Peptide - C-terminal region

Produktübersicht

• Artikelname: AK8 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004115
• Hersteller Artikelnummer: orb2004115
• Alternativnummer: BYT-ORB2004115-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: C9orf98, DDX31, RP11-143F18.1

Produktbeschreibung

AK8 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 689785
• UniProt: Q96MA6
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with AK8 Rabbit Polyclonal Antibody (orb325816). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings