AK8 Peptide - C-terminal region

Product Overview

• Article Name: AK8 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004115
• Supplier Catalog Number: orb2004115
• Alternative Catalog Number: BYT-ORB2004115-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: C9orf98, DDX31, RP11-143F18.1

Product Description

AK8 Peptide - C-terminal region

Product Properties

• NCBI: 689785
• UniProt: Q96MA6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with AK8 Rabbit Polyclonal Antibody (orb325816). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings