C16orf46 Peptide - C-terminal region

Produktübersicht

• Artikelname: C16orf46 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004116
• Hersteller Artikelnummer: orb2004116
• Alternativnummer: BYT-ORB2004116-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

C16orf46 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 689550
• UniProt: Q6P387
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: ALQLLQKRGVQSYKSKFKAKEPRSPVITRKHVLPKAKQENRPQMLETKVF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with C16orf46 Rabbit Polyclonal Antibody (orb325798). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings