C16orf46 Peptide - C-terminal region

Product Overview

• Article Name: C16orf46 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004116
• Supplier Catalog Number: orb2004116
• Alternative Catalog Number: BYT-ORB2004116-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

C16orf46 Peptide - C-terminal region

Product Properties

• NCBI: 689550
• UniProt: Q6P387
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ALQLLQKRGVQSYKSKFKAKEPRSPVITRKHVLPKAKQENRPQMLETKVF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with C16orf46 Rabbit Polyclonal Antibody (orb325798). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings