FAP Peptide - C-terminal region

Produktübersicht

• Artikelname: FAP Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004120
• Hersteller Artikelnummer: orb2004120
• Alternativnummer: BYT-ORB2004120-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: DPPIV, FAPA

Produktbeschreibung

FAP Peptide - C-terminal region

Produkteigenschaften

• NCBI: 004451
• UniProt: Q12884
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with FAP Rabbit Polyclonal Antibody (orb579794). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings