FAP Peptide - C-terminal region

Product Overview

• Article Name: FAP Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004120
• Supplier Catalog Number: orb2004120
• Alternative Catalog Number: BYT-ORB2004120-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: DPPIV, FAPA

Product Description

FAP Peptide - C-terminal region

Product Properties

• NCBI: 004451
• UniProt: Q12884
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with FAP Rabbit Polyclonal Antibody (orb579794). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings