ECM1 Peptide - middle region

Artikelnummer: BYT-ORB2004121
Artikelname: ECM1 Peptide - middle region
Artikelnummer: BYT-ORB2004121
Hersteller Artikelnummer: orb2004121
Alternativnummer: BYT-ORB2004121-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
ECM1 Peptide - middle region
NCBI: 073155
UniProt: Q16610
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ECM1 Rabbit Polyclonal Antibody (orb579791). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings