ECM1 Peptide - middle region

Catalog Number: BYT-ORB2004121
Article Name: ECM1 Peptide - middle region
Biozol Catalog Number: BYT-ORB2004121
Supplier Catalog Number: orb2004121
Alternative Catalog Number: BYT-ORB2004121-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
ECM1 Peptide - middle region
NCBI: 073155
UniProt: Q16610
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ECM1 Rabbit Polyclonal Antibody (orb579791). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings