ADAM23 Peptide - N-terminal region

Produktübersicht

• Artikelname: ADAM23 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004122
• Hersteller Artikelnummer: orb2004122
• Alternativnummer: BYT-ORB2004122-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: MDC3

Produktbeschreibung

ADAM23 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 003803
• UniProt: O75077
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ADAM23 Rabbit Polyclonal Antibody (orb330481). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings