ADAM23 Peptide - N-terminal region

Product Overview

• Article Name: ADAM23 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004122
• Supplier Catalog Number: orb2004122
• Alternative Catalog Number: BYT-ORB2004122-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MDC3

Product Description

ADAM23 Peptide - N-terminal region

Product Properties

• NCBI: 003803
• UniProt: O75077
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ADAM23 Rabbit Polyclonal Antibody (orb330481). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings