CRYZL1 Peptide - C-terminal region

Produktübersicht

• Artikelname: CRYZL1 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004123
• Hersteller Artikelnummer: orb2004123
• Alternativnummer: BYT-ORB2004123-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: 4P11, QOH-1

Produktbeschreibung

CRYZL1 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 665857
• UniProt: O95825
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGATLAFLNDEVW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with CRYZL1 Rabbit Polyclonal Antibody (orb579608). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings