CRYZL1 Peptide - C-terminal region

Product Overview

• Article Name: CRYZL1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004123
• Supplier Catalog Number: orb2004123
• Alternative Catalog Number: BYT-ORB2004123-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 4P11, QOH-1

Product Description

CRYZL1 Peptide - C-terminal region

Product Properties

• NCBI: 665857
• UniProt: O95825
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGATLAFLNDEVW

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with CRYZL1 Rabbit Polyclonal Antibody (orb579608). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings