FAM3B Peptide - middle region

Artikelnummer: BYT-ORB2004124
Artikelname: FAM3B Peptide - middle region
Artikelnummer: BYT-ORB2004124
Hersteller Artikelnummer: orb2004124
Alternativnummer: BYT-ORB2004124-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: 2-21, C21orf11, C21orf76, ORF9, PANDER
FAM3B Peptide - middle region
NCBI: 996847
UniProt: P58499
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: HWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIV
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with FAM3B Rabbit Polyclonal Antibody (orb579607). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings