FAM3B Peptide - middle region

Product Overview

• Article Name: FAM3B Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004124
• Supplier Catalog Number: orb2004124
• Alternative Catalog Number: BYT-ORB2004124-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 2-21, C21orf11, C21orf76, ORF9, PANDER

Product Description

FAM3B Peptide - middle region

Product Properties

• NCBI: 996847
• UniProt: P58499
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: HWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with FAM3B Rabbit Polyclonal Antibody (orb579607). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings