CFAP410 Peptide - C-terminal region

Produktübersicht

• Artikelname: CFAP410 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004125
• Hersteller Artikelnummer: orb2004125
• Alternativnummer: BYT-ORB2004125-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: RDMS, SMDAX, LRRC76, YF5/A2, C21orf2

Produktbeschreibung

CFAP410 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 004919
• UniProt: O43822
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with CFAP410 Rabbit Polyclonal Antibody (orb579585). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings