CFAP410 Peptide - C-terminal region

Product Overview

• Article Name: CFAP410 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004125
• Supplier Catalog Number: orb2004125
• Alternative Catalog Number: BYT-ORB2004125-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: RDMS, SMDAX, LRRC76, YF5/A2, C21orf2

Product Description

CFAP410 Peptide - C-terminal region

Product Properties

• NCBI: 004919
• UniProt: O43822
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: DPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSSHRGRNVLTAILL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with CFAP410 Rabbit Polyclonal Antibody (orb579585). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings