FKTN Peptide - N-terminal region

Produktübersicht

• Artikelname: FKTN Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004130
• Hersteller Artikelnummer: orb2004130
• Alternativnummer: BYT-ORB2004130-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: CMD1X, FCMD, LGMD2M, MDDGA4, MDDGB4, MDDGC4

Produktbeschreibung

FKTN Peptide - N-terminal region

Produkteigenschaften

• NCBI: 006722
• UniProt: O75072
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LLTLTSSAFLLFQLYYYKHYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with FKTN Rabbit Polyclonal Antibody (orb579370). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings