FKTN Peptide - N-terminal region

Product Overview

• Article Name: FKTN Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004130
• Supplier Catalog Number: orb2004130
• Alternative Catalog Number: BYT-ORB2004130-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CMD1X, FCMD, LGMD2M, MDDGA4, MDDGB4, MDDGC4

Product Description

FKTN Peptide - N-terminal region

Product Properties

• NCBI: 006722
• UniProt: O75072
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LLTLTSSAFLLFQLYYYKHYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with FKTN Rabbit Polyclonal Antibody (orb579370). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings