GALNTL6 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004134
Artikelname: GALNTL6 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004134
Hersteller Artikelnummer: orb2004134
Alternativnummer: BYT-ORB2004134-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: GALNT17
GALNTL6 Peptide - N-terminal region
NCBI: 001030017
UniProt: Q49A17
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with GALNTL6 Rabbit Polyclonal Antibody (orb579300). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings