GALNTL6 Peptide - N-terminal region

Product Overview

• Article Name: GALNTL6 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004134
• Supplier Catalog Number: orb2004134
• Alternative Catalog Number: BYT-ORB2004134-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: GALNT17

Product Description

GALNTL6 Peptide - N-terminal region

Product Properties

• NCBI: 001030017
• UniProt: Q49A17
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with GALNTL6 Rabbit Polyclonal Antibody (orb579300). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings